PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 963aa    MW: 108507 Da    PI: 5.0153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04943.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
       KHN04943.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
       KHN04943.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.1E-131070No hitNo description
CDDcd001677.30E-121053No hitNo description
SuperFamilySSF466898.27E-2133106IPR009057Homeodomain-like
CDDcd116591.48E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.1E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.3E-61406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051301Biological Processcell division
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 963 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TKGKKAKRKA REKQLEEARR  180
LASLQKKREL KAAGIDIRQR KRKRKGIDYN AEIPFEKRPP PGFFDVTDED RPVEQPQFPT  240
TIEELEGKRR VDVEAQLRKQ DIAKNKIAQR QDAPSAILHA NKLNDPETVR KRSKLMLPPP  300
QISDQELDEI AKLGYASDLA GSQELAEGSG ATRALLADYA QTPGQGMTPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGENPELH PSDFNGVTPK KKEIQTPNPM LTPSATPGGA  420
GLTPRIGMTP TRDGFSFSMT PKGTPLRDEL HINEDMNMHD STKLELQRQA DMRRSLRSGL  480
GSLPQPKNEY QIVMQPVPED AEEPEEKIEE DMSDRIAREK AEEEARQQAL LRKRSKVLQR  540
ELPRPPTASL ELIRNSLMRT DVDKSSFVPP TSIEQADEMI RRELLSLLEH DNAKYPLDEK  600
VIKEKKKGAK RAVNGSAVPV IEDFEEDEMK EADKLIKEEA LYLCAAMGHE DEPLDEFIEA  660
HRTCLNDLMY FPTRNAYGLS SVAGNMEKLT ALQNEFENVR SKLDDDKEKM VRLEKKVMVL  720
TQGYEMRVKK SLWPQIEATF KQMDVAATEL ECFKALQKQE QLAASHRINN LWAEVQKQKE  780
LEKTLQNRYG SLIEELEKMQ NVMDQCRLQA QQQEEIKANH ARESTETPET KADGIDVQGT  840
ANCEAVPHSV EHGRALAVES SADGTADQQV DIVHDQATSS VSHDMDVDSD KLANPTPAAE  900
NVDEKVEGTG TGTGSYTDDG ETMLEMGAAV EVSSPNHDVV VDAVNSHDNN SMEETNAVGE  960
ETY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KKRELKAAGIDIRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556457.10.0PREDICTED: cell division cycle 5-like protein isoform X1
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0B2PB650.0A0A0B2PB65_GLYSO; Cell division cycle 5-like protein
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]